Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG011330t3
Common NameTCM_011330
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 751aa    MW: 81842.8 Da    PI: 6.0549
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG011330t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++e+e++F+++++p+ ++r+eL ++lgL+  qVk+WFqN+R+++k
                       688999***********************************************999 PP

             START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                       ela +a++el+++a+ +ep+W++s     +++n++e++++f+++ +     ++ ea+r+++vv+m++ +lve+l+d+  qW++ +     ka+
                       57899**************************************999********************************.************** PP

             START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                       tl+v+s+g      galq+m+ae+q++splvp R++++vRy++q+ +g+w++vdvS+d+ ++ p+    vR++++pSg+li++++ng+skvtw
                       **************************************************************996....************************ PP

             START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       vehv++++r +h+l+++lv+sg+a+gak+w atl+rqce+
                       **************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.58487147IPR001356Homeobox domain
SMARTSM003891.3E-1988151IPR001356Homeobox domain
CDDcd000862.03E-1890148No hitNo description
PfamPF000461.7E-1790145IPR001356Homeobox domain
PROSITE profilePS5084845.652264496IPR002913START domain
SuperFamilySSF559613.3E-36266495No hitNo description
CDDcd088759.49E-132268492No hitNo description
SMARTSM002343.0E-68273493IPR002913START domain
PfamPF018522.2E-60274493IPR002913START domain
Gene3DG3DSA:3.30.530.204.8E-6369479IPR023393START-like domain
SuperFamilySSF559616.87E-23513742No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007045613.10.0Homeodomain GLABROUS 2 isoform 3
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLA0A061E8V70.0A0A061E8V7_THECC; Homeodomain GLABROUS 2 isoform 3
STRINGPOPTR_0014s15010.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.30.0homeodomain GLABROUS 2
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53